falkenstein mcm swag light
Home & Living > Lighting > Light Fixtures > Ceiling Lights > Pendant Lights
Listings
9
Avg Price
$421
Shops
7
Opportunity
/100
Price Distribution
$250+ 100%
Top Tags
hollywood regencyfalkensteinlampswagpendantmid centurymcmvintagechainmcm lampglobe lighthanging lightvintage lightswag lampmcm swag light
Top Listings
#1
Vintage Karl Falkenstein Swag Lamp: Iridescent Glass Floral Pendant Light
by DeesNewOldGems (7.1K sales) · $350 · 64 favorites
#2
Vintage swag lamp iridescent peachy gold glass Falkenstein Hollywood regency moriage texture floral LARGE
by RetroChiqueShop (1.5K sales) · $400 · 12 favorites
#3
Falkenstein Bubble Glass Plug-in Swag Light Vintage 1970s Floral Motif
by Lillypadsandlace (2.9K sales) · $344 · 26 favorites
#4
Vintage Falkenstein Swag Lamp, Floral Hand-Painted Goldleaf Roses With New Wiring
by RenewedHeartsCompany (720 sales) · $449 · 4 favorites
#5
Beautiful Pearl/ Iridescent 1970s Falkenstein Table Lamp and Swag Light Set with 8 Bubble Floral Motif Vintage/ Retro/M
by Lillypadsandlace (2.9K sales) · $524 · 11 favorites
#6
MCM Vintage Large Hollywood regency Carl Falkenstein Style Hanging plug in swag lamp iridescent glass round Gold texture
by GoldensquaremileShop (729 sales) · $350 · 4 favorites
#7
Mid Cent Vint CARL FALKENSTEIN - Double SWAG Lamp - Works
by AlioopsTreasures (9.6K sales) · $380 · 17 favorites
#8
Vintage Karl Falkenstein Swag Lamp: Mid Century Crackle Glass Pendant
by DeesNewOldGems (7.1K sales) · $550 · 46 favorites
#9
Vintage 1970s Plug-in Swag Lamp, Large Ornate Pearl Glass Lantern, Hollywood Regency, Victorian Floral Scroll Filligree
by KatevintageDesign (642 sales) · $495 · 14 favorites
Top shops for "falkenstein mcm swag light"
Nearby Opportunities
| Keyword | Sellers | Competition |
|---|---|---|
| falkeldesign | 1 | Wide open |
| falda purepecha | 1 | Wide open |
| faldas de bomba | 1 | Wide open |
| falstaff fishing | 1 | Wide open |
| fallgold raspberry | 2 | Wide open |
| fallujah patch | 2 | Wide open |
| falda manton | 2 | Wide open |
| falls risk badge reel | 3 | Wide open |
| falmouth road race | 3 | Wide open |
| falstaff rose | 5 | Wide open |
| fallacy dice | 5 | Wide open |
| fallen celestial miniature 100mm | 6 | Wide open |
| fallacy detective | 6 | Wide open |
| falmouth wallpaper | 4 | Wide open |
| falls church tote | 6 | Wide open |