falkenstein
Home & Living > Lighting > Lamps, Shades & Bases > Lamps > Table Lamps
Listings
131
Avg Price
$204
Shops
23
Opportunity
/100
Price Distribution
$0–10 12%
$10–25 4%
$25–50 8%
$50–100 8%
$100–250 24%
$250+ 44%
Top Tags
hollywood regencybrassvintagecarl falkensteinfalkensteincrystallampmid centurymid century lampvintage lampgone with the windwine region wall artaustria wall printfalkenstein artworkgift for wine lovers
Top Listings
#1
Vintage, Hollywood Regency, Carl Falkenstein Style, Italian Table Lamp, Gold motif on white, Brass Base, MCM, Floor Lamp
by PinkAsMuch (8.4K sales) · $203 · 25 favorites
#2
European Wine Regions Print Set. Wachau, Weinviertel & Znojmo. Watercolor Style (Digital Download)
by TheGrapeTruth (4 sales) · $9.73 · 0 favorites
#3
Stunning Vintage Cal Falkenstein Hollywood Regency Hanging Lamp
by Soymarket24 (52 sales) · $358 · 6 favorites
#4
COPIE Vénus de SCHANZBODEN Falkenstein (pierre de faucon) Néolithique Dim: 13 cm. Stadtmuseum Poysdorf. Autriche Terre
by PALEOSCOPEPALEOLODGE (1.5K sales) · $135 · 14 favorites
#5
Falkenstein Castle & Church. Austrian Weinviertel Printable Art. Watercolor Style (Digital Download)
by TheGrapeTruth (4 sales) · $4.99 · 1 favorites
#6
Gold Floral Hollywood Regency, Brass, Table Lamp, Vintage, MCM, tablelamp, Boho, Retro, Hand Painted
by DeesNewOldGems (7.1K sales) · $200 · 15 favorites
#7
Beautiful Mid Century/ Hollywood Regency Falkenstein Gold/White opalescent Jeweled and Glass Prisms Table Lamp Free Ship
by DevonGionni (1.6K sales) · $399 · 82 favorites
#8
Vintage Hollywood Regency Opalescent Glass Lamps (Set of 2) – Carl Falkenstein Style 1970s
by CheckEngineVintage (6.3K sales) · $395 · 2 favorites
#9
Vintage Yellow Carnival Glass Bubble Lamp: Carl Falkenstein Iridescent Floral Hollywood Regency
by ARPeddlerWagon (1.1K sales) · $250 · 47 favorites
#10
Clear Crackle Pull-Chain Glass Hanging Vintage Gold Light Swag Lamp Retro Antique Diffuser FALKENSTEIN Globe Mid Century
by Rainbowsandstars10 (253 sales) · $275 · 2 favorites
Top shops for "falkenstein"
Nearby Opportunities
| Keyword | Sellers | Competition |
|---|---|---|
| falkeldesign | 1 | Wide open |
| falda purepecha | 1 | Wide open |
| faldas de bomba | 1 | Wide open |
| falstaff fishing | 1 | Wide open |
| fallgold raspberry | 2 | Wide open |
| fallujah patch | 2 | Wide open |
| falda manton | 2 | Wide open |
| falls risk badge reel | 3 | Wide open |
| falmouth road race | 3 | Wide open |
| falstaff rose | 5 | Wide open |
| fallacy dice | 5 | Wide open |
| fallen celestial miniature 100mm | 6 | Wide open |
| fallacy detective | 6 | Wide open |
| falmouth wallpaper | 4 | Wide open |
| falls church tote | 6 | Wide open |